Recombinant Rat Beta-nerve growth factor (Ngf)
Catalog Number:
CSB-YP015779RA
- Images (0)
| Article Name: | Recombinant Rat Beta-nerve growth factor (Ngf) |
| Biozol Catalog Number: | CSB-YP015779RA |
| Supplier Catalog Number: | CSB-YP015779RA |
| Alternative Catalog Number: | CSB-YP015779RA-1, CSB-YP015779RA-100, CSB-YP015779RA-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Ngf, Ngfb, Beta-nerve growth factor, Beta-NGF |
| Molecular Weight: | 15.4 kDa |
| Tag: | N-terminal 6xHis-tagged |
| UniProt: | P25427 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Yeast |
| Expression System: | 122-241aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | SSTHPVFHMGEFSVCDSVSVWVGDKTTATDIKGKEVTVLGEVNINNSVFKQYFFETKCRAPNPVESGCRGIDSKHWNSYCTTTHTFVKALTTDDKQAAWRFIRIDTACVCVLSRKAARRG |
Product Guarantee and Expert Support
