Recombinant Human Protein BEX3 (NGFRAP1)
Catalog Number:
CSB-YP015781HU
- Images (0)
| Article Name: | Recombinant Human Protein BEX3 (NGFRAP1) |
| Biozol Catalog Number: | CSB-YP015781HU |
| Supplier Catalog Number: | CSB-YP015781HU |
| Alternative Catalog Number: | CSB-YP015781HU-1, CSB-YP015781HU-100, CSB-YP015781HU-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Brain-expressed X-linked protein 3Nerve growth factor receptor-associated protein 1Ovarian granulosa cell 13.0KDA protein HGR74p75NTR-associated cell death executor |
| Molecular Weight: | 15 kDa |
| Tag: | N-terminal 6xHis-tagged |
| UniProt: | Q00994 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Yeast |
| Expression System: | 1-111aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | MANIHQENEEMEQPMQNGEEDRPLGGGEGHQPAGNRRGQARRLAPNFRWAIPNRQINDGMGGDGDDMEIFMEEMREIRRKLRELQLRNCLRILMGELSNHHDHHDEFCLMP |
Product Guarantee and Expert Support
