Recombinant Human NHP2-like protein 1 (NHP2L1)
Catalog Number:
CSB-YP015794HU
- Images (0)
| Article Name: | Recombinant Human NHP2-like protein 1 (NHP2L1) |
| Biozol Catalog Number: | CSB-YP015794HU |
| Supplier Catalog Number: | CSB-YP015794HU |
| Alternative Catalog Number: | CSB-YP015794HU-1, CSB-YP015794HU-100, CSB-YP015794HU-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | High mobility group-like nuclear protein 2 homolog 1OTK27SNU13 homolog ,hSNU13U4/U6.U5 tri-snRNP 15.5KDA protein |
| Molecular Weight: | 16 kDa |
| Tag: | N-terminal 6xHis-tagged |
| UniProt: | P55769 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Yeast |
| Expression System: | 2-128aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | TEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERLLV |
Product Guarantee and Expert Support
