Recombinant Mouse Pro-neuropeptide Y (Npy), partial
Catalog Number:
CSB-YP016034MO
- Images (0)
| Article Name: | Recombinant Mouse Pro-neuropeptide Y (Npy), partial |
| Biozol Catalog Number: | CSB-YP016034MO |
| Supplier Catalog Number: | CSB-YP016034MO |
| Alternative Catalog Number: | CSB-YP016034MO-1, CSB-YP016034MO-100, CSB-YP016034MO-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Pro-neuropeptide Y [Cleaved into: Neuropeptide Y(Neuropeptide tyrosine)(NPY), C-flanking peptide of NPY(CPON)] |
| Molecular Weight: | 30.9 kDa |
| Tag: | N-terminal hFc-tagged |
| UniProt: | P57774 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Yeast |
| Expression System: | 29-64aa |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY |
Product Guarantee and Expert Support
