Recombinant Human Nuclear receptor subfamily 4 group A member 1 (NR4A1)
Catalog Number:
CSB-YP016062HU
- Images (0)
| Article Name: | Recombinant Human Nuclear receptor subfamily 4 group A member 1 (NR4A1) |
| Biozol Catalog Number: | CSB-YP016062HU |
| Supplier Catalog Number: | CSB-YP016062HU |
| Alternative Catalog Number: | CSB-YP016062HU-1, CSB-YP016062HU-100, CSB-YP016062HU-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | (Early response protein NAK1)(Nuclear hormone receptor NUR/77)(Nur77)(Orphan nuclear receptor HMR)(Orphan nuclear receptor TR3)(ST-59)(Testicular receptor 3) |
| Molecular Weight: | 68.2 kDa |
| Tag: | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| UniProt: | P22736 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Yeast |
| Expression System: | 1-598aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | MPCIQAQYGTPAPSPGPRDHLASDPLTPEFIKPTMDLASPEAAPAAPTALPSFSTFMDGYTGEFDTFLYQLPGTVQPCSSASSSASSTSSSSATSPASASFKFEDFQVYGCYPGPLSGPVDEALSSSGSDYYGSPCSAPSPSTPSFQPPQLSPWDGSFGHFSPSQTYEGLRAWTEQLPKASGPPQPPAFFSFSPPTGPSPSLAQSPLKLFPSQATHQLGEGESYSMPTAFPGLAPTSPHLEGSGILDTPVTSTK |
Product Guarantee and Expert Support
