Recombinant Human 7,8-dihydro-8-oxoguanine triphosphatase (NUDT1)
Catalog Number:
CSB-YP016154HUA0
- Images (0)
| Article Name: | Recombinant Human 7,8-dihydro-8-oxoguanine triphosphatase (NUDT1) |
| Biozol Catalog Number: | CSB-YP016154HUA0 |
| Supplier Catalog Number: | CSB-YP016154HUa0 |
| Alternative Catalog Number: | CSB-YP016154HUA0-1, CSB-YP016154HUA0-100, CSB-YP016154HUA0-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | 2-hydroxy-dATP diphosphatase (EC:3.6.1.56) 8-oxo-dGTPase Nucleoside diphosphate-linked moiety X motif 1 MTH1 |
| Molecular Weight: | 22.3 kDa |
| Tag: | N-terminal 6xHis-tagged |
| UniProt: | P36639 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Yeast |
| Expression System: | 19-197aa |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | MSGISPQQMGEPEGSWSGKNPGTMGASRLYTLVLVLQPQRVLLGMKKRGFGAGRWNGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQIVFEFVGEPELMDVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMWPDDSYWFPLLLQKKKFHGYFKFQGQDTILDYTLREVDTV |
Product Guarantee and Expert Support
