Recombinant Rat Oncomodulin (Ocm)

Catalog Number: CSB-YP016264RA
Article Name: Recombinant Rat Oncomodulin (Ocm)
Biozol Catalog Number: CSB-YP016264RA
Supplier Catalog Number: CSB-YP016264RA
Alternative Catalog Number: CSB-YP016264RA-1, CSB-YP016264RA-100, CSB-YP016264RA-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Parvalbumin beta,CSB-PR2024
Molecular Weight: 14.5 kDa
Tag: N-terminal 10xHis-tagged
UniProt: P02631
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Yeast
Expression System: 2-109aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: SITDILSAEDIAAALQECQDPDTFEPQKFFQTSGLSKMSASQVKDIFRFIDNDQSGYLDGDELKYFLQKFQSDARELTESETKSLMDAADNDGDGKIGADEFQEMVHS