Recombinant Human Oligodendrocyte transcription factor 1 (OLIG1), partial
Catalog Number:
CSB-YP016328HU
- Images (0)
| Article Name: | Recombinant Human Oligodendrocyte transcription factor 1 (OLIG1), partial |
| Biozol Catalog Number: | CSB-YP016328HU |
| Supplier Catalog Number: | CSB-YP016328HU |
| Alternative Catalog Number: | CSB-YP016328HU-1, CSB-YP016328HU-100, CSB-YP016328HU-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Class B basic helix-loop-helix protein 6 Short name: bHLHb6 Class E basic helix-loop-helix protein 21 Short name: bHLHe21 |
| Molecular Weight: | 11.1 kDa |
| Tag: | N-terminal 6xHis-tagged |
| UniProt: | Q8TAK6 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Yeast |
| Expression System: | 17-105aa |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | MLRPQRPGDLQLGASLYELVGYRQPPSSSSSSTSSTSSTSSSSTTAPLLPKAAREKPEAPAEPPGPGPGSGAHPGGSARPDAKEEQQQQ |
Product Guarantee and Expert Support
