Recombinant Human Oxytocin-neurophysin 1 (OXT)
Catalog Number:
CSB-YP017315HU(A4)
- Images (0)
| Article Name: | Recombinant Human Oxytocin-neurophysin 1 (OXT) |
| Biozol Catalog Number: | CSB-YP017315HU(A4) |
| Supplier Catalog Number: | CSB-YP017315HU(A4) |
| Alternative Catalog Number: | CSB-YP017315HU(A4)-1, CSB-YP017315HU(A4)-100, CSB-YP017315HU(A4)-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Ocytocin |
| Molecular Weight: | 10.9 kDa |
| Tag: | Tag-Free |
| UniProt: | P01178 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Yeast |
| Expression System: | 20-125aa |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | CYIQNCPLGGKRAAPDLDVRKCLPCGPGGKGRCFGPNICCAEELGCFVGTAEALRCQEENYLPSPCQSGQKACGSGGRCAVLGLCCSPDGCHADPACDAEATFSQR |
Product Guarantee and Expert Support
