Recombinant Human Poly (A)-specific ribonuclease PARN (PARN)

Catalog Number: CSB-YP017456HU
Article Name: Recombinant Human Poly (A)-specific ribonuclease PARN (PARN)
Biozol Catalog Number: CSB-YP017456HU
Supplier Catalog Number: CSB-YP017456HU
Alternative Catalog Number: CSB-YP017456HU-1, CSB-YP017456HU-100, CSB-YP017456HU-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Deadenylating nucleaseDeadenylation nucleasePolyadenylate-specific ribonuclease
Molecular Weight: 75.5 kDa
Tag: N-terminal 6xHis-tagged
UniProt: O95453
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Yeast
Expression System: 1-639aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MEIIRSNFKSNLHKVYQAIEEADFFAIDGEFSGISDGPSVSALTNGFDTPEERYQKLKKHSMDFLLFQFGLCTFKYDYTDSKYITKSFNFYVFPKPFNRSSPDVKFVCQSSSIDFLASQGFDFNKVFRNGIPYLNQEEERQLREQYDEKRSQANGAGALSYVSPNTSKCPVTIPEDQKKFIDQVVEKIEDLLQSEENKNLDLEPCTGFQRKLIYQTLSWKYPKGIHVETLETEKKERYIVISKVDEEERKRREQ