Recombinant Saccharomyces cerevisiae ProlifeRating cell nuclear antigen (POL30)

Catalog Number: CSB-YP017621SVG
Article Name: Recombinant Saccharomyces cerevisiae ProlifeRating cell nuclear antigen (POL30)
Biozol Catalog Number: CSB-YP017621SVG
Supplier Catalog Number: CSB-YP017621SVG
Alternative Catalog Number: CSB-YP017621SVG-1, CSB-YP017621SVG-100, CSB-YP017621SVG-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Short name: PCNA
Molecular Weight: 30.9 kDa
Tag: N-terminal 6xHis-tagged
UniProt: P15873
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Yeast
Expression System: 1-258aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MLEAKFEEASLFKRIIDGFKDCVQLVNFQCKEDGIIAQAVDDSRVLLVSLEIGVEAFQEYRCDHPVTLGMDLTSLSKILRCGNNTDTLTLIADNTPDSIILLFEDTKKDRIAEYSLKLMDIDADFLKIEELQYDSTLSLPSSEFSKIVRDLSQLSDSINIMITKETIKFVADGDIGSGSVIIKPFVDMEHPETSIKLEMDQPVDLTFGAKYLLDIIKGSSLSDRVGIRLSSEAPALFQFDLKSGFLQFFLAPKF