Recombinant Mouse Proprotein convertase subtilisin/kexin type 5 (Pcsk5), partial
Catalog Number:
CSB-YP017644MO
- Images (0)
| Article Name: | Recombinant Mouse Proprotein convertase subtilisin/kexin type 5 (Pcsk5), partial |
| Biozol Catalog Number: | CSB-YP017644MO |
| Supplier Catalog Number: | CSB-YP017644MO |
| Alternative Catalog Number: | CSB-YP017644MO-1, CSB-YP017644MO-100, CSB-YP017644MO-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Proprotein convertase 5 Short name: PC5 Proprotein convertase 6 Short name: PC6 Subtilisin-like proprotein convertase 6 Short name: SPC6 Subtilisin/kexin-like protease PC5 |
| Molecular Weight: | 38.7 kDa |
| Tag: | N-terminal 6xHis-tagged |
| UniProt: | Q04592 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Yeast |
| Expression System: | 117-452aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | DYDLSHAQSTYFNDPKWPSMWYMHCSDNTHPCQSDMNIEGAWKRGYTGKNIVVTILDDGIERTHPDLMQNYDALASCDVNGNDLDPMPRYDASNENKHGTRCAGEVAATANNSHCTVGIAFNAKIGGVRMLDGDVTDMVEAKSVSYNPQHVHIYSASWGPDDDGKTVDGPAPLTRQAFENGVRMGRRGLGSVFVWASGNGGRSKDHCSCDGYTNSIYTISISSTAESGKKPWYLEECSSTLATTYSSGESYDKK |
Product Guarantee and Expert Support
