Recombinant Staphylococcus aureus Peptide deformylase (def)

Catalog Number: CSB-YP017707FKZ
Article Name: Recombinant Staphylococcus aureus Peptide deformylase (def)
Biozol Catalog Number: CSB-YP017707FKZ
Supplier Catalog Number: CSB-YP017707FKZ
Alternative Catalog Number: CSB-YP017707FKZ-1, CSB-YP017707FKZ-100, CSB-YP017707FKZ-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Polypeptide deformylase
Molecular Weight: 22.6 kDa
Tag: N-terminal 6xHis-tagged
UniProt: P68826
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Yeast
Expression System: 1-183aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MLTMKDIIRDGHPTLRQKAAELELPLTKEEKETLIAMREFLVNSQDEEIAKRYGLRSGVGLAAPQINISKRMIAVLIPDDGSGKSYDYMLVNPKIVSHSVQEAYLPTGEGCLSVDDNVAGLVHRHNRITIKAKDIEGNDIQLRLKGYPAIVFQHEIDHLNGVMFYDHIDKNHPLQPHTDAVEV