Recombinant Pig Platelet factor 4 (PF4)
Catalog Number:
CSB-YP017809PI
- Images (0)
| Article Name: | Recombinant Pig Platelet factor 4 (PF4) |
| Biozol Catalog Number: | CSB-YP017809PI |
| Supplier Catalog Number: | CSB-YP017809PI |
| Alternative Catalog Number: | CSB-YP017809PI-1, CSB-YP017809PI-100, CSB-YP017809PI-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | (PF-4)(C-X-C motif chemokine 4) |
| Molecular Weight: | 36.7 kDa |
| Tag: | N-terminal mFc-tagged |
| UniProt: | P30034 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Yeast |
| Expression System: | 1-90aa |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | QEWSLPGTRVPPPADPEGGDANLRCVCVKTISGVSPKHISSLEVIGAGPHCPSPQLIATLKKGHKICLDPQNLLYKKIIKKLLKSQLLTA |
Product Guarantee and Expert Support
