Recombinant Pseudechis porphyriacus Basic phospholipase A2 pseudexin B chain
Catalog Number:
CSB-YP018091EZTA4
- Images (0)
| Article Name: | Recombinant Pseudechis porphyriacus Basic phospholipase A2 pseudexin B chain |
| Biozol Catalog Number: | CSB-YP018091EZTA4 |
| Supplier Catalog Number: | CSB-YP018091EZTa4 |
| Alternative Catalog Number: | CSB-YP018091EZTA4-1, CSB-YP018091EZTA4-100, CSB-YP018091EZTA4-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Phosphatidylcholine 2-acylhydrolase |
| Molecular Weight: | 29 kDa |
| Tag: | N-terminal 6xHis-sumostar-tagged |
| UniProt: | P20259 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Yeast |
| Expression System: | 1-117aa |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | NLIQFSNMIKCAIPGSRPLFQYADYGCYCGPGGHGTPVDELDRCCKIHDDCYGEAGKKGCFPKLTLYSWKCTEKVPTCNAKSRCKDFVCACDAEAAKCFAKAPYIKENYNINTKTRC |
Product Guarantee and Expert Support
