Recombinant Human Peroxiredoxin-1 (PRDX1)
Catalog Number:
CSB-YP018653HUA0
- Images (0)
| Article Name: | Recombinant Human Peroxiredoxin-1 (PRDX1) |
| Biozol Catalog Number: | CSB-YP018653HUA0 |
| Supplier Catalog Number: | CSB-YP018653HUa0 |
| Alternative Catalog Number: | CSB-YP018653HUA0-1, CSB-YP018653HUA0-100, CSB-YP018653HUA0-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Natural killer cell-enhancing factor A Proliferation-associated gene protein Thioredoxin peroxidase 2 Thioredoxin-dependent peroxide reductase 2,CSB-PR2024 |
| Molecular Weight: | 24.1 kDa |
| Tag: | N-terminal 6xHis-tagged |
| UniProt: | Q06830 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Yeast |
| Expression System: | 1-199aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | MSSGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYFSKQK |
Product Guarantee and Expert Support
