Recombinant Human Glycogen phosphorylase, liver form (PYGL),partial

Product Overview

• Article Name: Recombinant Human Glycogen phosphorylase, liver form (PYGL),partial
• Biozol Catalog Number: CSB-YP019122HU
• Supplier Catalog Number: CSB-YP019122HU
• Alternative Catalog Number: CSB-YP019122HU-1, CSB-YP019122HU-100, CSB-YP019122HU-20
• Manufacturer: Cusabio
• Category: Proteine/Peptide
• Alternative Names: Glycogen phosphorylase, Glycogen phosphorylase L, Glycogen phosphorylase liver, Glycogen phosphorylase liver form, GSD6, Hers disease, glycogen storage disease type VI, liver form, OTTHUMP00000233649, OTTHUMP00000233651, Phosphorylase glycogen liver, Pyg

Product Properties

• Molecular Weight: 98.9 kDa
• Tag: N-terminal 6xHis-tagged
• UniProt: P06737
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Yeast
• Expression System: 2-846aa
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: AKPLTDQEKRRQISIRGIVGVENVAELKKSFNRHLHFTLVKDRNVATTRDYYFALAHTVRDHLVGRWIRTQQHYYDKCPKRVYYLSLEFYMGRTLQNTMINLGLQNACDEAIYQLGLDIEELEEIEEDAGLGNGGLGRLAACFLDSMATLGLAAYGYGIRYEYGIFNQKIRDGWQVEEADDWLRYGNPWEKSRPEFMLPVHFYGKVEHTNTGTKWIDTQVVLALPYDTPVPGYMNNTVNTMRLWSARAPNDFNL