Recombinant Human Proto-oncogene c-Rel (REL), partial

Product Overview

• Article Name: Recombinant Human Proto-oncogene c-Rel (REL), partial
• Biozol Catalog Number: CSB-YP019552HU
• Supplier Catalog Number: CSB-YP019552HU
• Alternative Catalog Number: CSB-YP019552HU-1, CSB-YP019552HU-100, CSB-YP019552HU-20
• Manufacturer: Cusabio
• Category: Proteine/Peptide
• Alternative Names: Avian reticuloendotheliosis , C REL, C Rel protein, c Rel proto oncogene protein, Oncogene REL , Oncogene REL avian reticuloendotheliosis, Proto-oncogene c-Rel, REL, REL_HUMAN, v rel avian reticuloendotheliosis viral oncogene homolog, v rel reticuloendot,CSB-PR2024

Product Properties

• Molecular Weight: 66.6 kDa
• Tag: N-terminal 6xHis-tagged
• UniProt: Q04864
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Yeast
• Expression System: 3-616aa
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: SGAYNPYIEIIEQPRQRGMRFRYKCEGRSAGSIPGEHSTDNNRTYPSIQIMNYYGKGKVRITLVTKNDPYKPHPHDLVGKDCRDGYYEAEFGQERRPLFFQNLGIRCVKKKEVKEAIITRIKAGINPFNVPEKQLNDIEDCDLNVVRLCFQVFLPDEHGNLTTALPPVVSNPIYDNRAPNTAELRICRVNKNCGSVRGGDEIFLLCDKVQKDDIEVRFVLNDWEAKGIFSQADVHRQVAIVFKTPPYCKAITEP