Recombinant Pig Rhodopsin (RHO), partial

Catalog Number: CSB-YP019681PI1
Article Name: Recombinant Pig Rhodopsin (RHO), partial
Biozol Catalog Number: CSB-YP019681PI1
Supplier Catalog Number: CSB-YP019681PI1
Alternative Catalog Number: CSB-YP019681PI1-1, CSB-YP019681PI1-100, CSB-YP019681PI1-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: RHO1
Molecular Weight: 6.2 kDa
Tag: N-terminal 6xHis-tagged
UniProt: O18766
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Yeast
Expression System: 1-36aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MNGTEGPNFYVPFSNKTGVVRSPFEYPQYYLAEPWQ