Recombinant Human 40S ribosomal protein SA (RPSA)

Product Overview

• Article Name: Recombinant Human 40S ribosomal protein SA (RPSA)
• Biozol Catalog Number: CSB-YP020485HU
• Supplier Catalog Number: CSB-YP020485HU
• Alternative Catalog Number: CSB-YP020485HU-1, CSB-YP020485HU-100, CSB-YP020485HU-20
• Manufacturer: Cusabio
• Category: Proteine/Peptide
• Alternative Names: 37 kDa laminin receptor precursor Short name: 37LRP 37/67 kDa laminin receptor Short name: LRP/LR 67 kDa laminin receptor Short name: 67LR Colon carcinoma laminin-binding protein Laminin receptor 1 Short name: LamR Laminin-binding protein precursor p40 S

Product Properties

• Molecular Weight: 34.7 kDa
• Tag: N-terminal 6xHis-tagged
• UniProt: P08865
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Yeast
• Expression System: 2-295aa
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: SGALDVLQMKEEDVLKFLAAGTHLGGTNLDFQMEQYIYKRKSDGIYIINLKRTWEKLLLAARAIVAIENPADVSVISSRNTGQRAVLKFAAATGATPIAGRFTPGTFTNQIQAAFREPRLLVVTDPRADHQPLTEASYVNLPTIALCNTDSPLRYVDIAIPCNNKGAHSVGLMWWMLAREVLRMRGTISREHPWEVMPDLYFYRDPEEIEKEEQAAAEKAVTKEEFQGEWTAPAPEFTATQPEVADWSEGVQVP