Recombinant Rabbit E-selectin (SELE), partial

Catalog Number: CSB-YP020975RB
Article Name: Recombinant Rabbit E-selectin (SELE), partial
Biozol Catalog Number: CSB-YP020975RB
Supplier Catalog Number: CSB-YP020975RB
Alternative Catalog Number: CSB-YP020975RB-1, CSB-YP020975RB-100, CSB-YP020975RB-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: CD62 antigen-like family member EEndothelial leukocyte adhesion molecule 1 ,ELAM-1Leukocyte-endothelial cell adhesion molecule 2 ,LECAM2,, CD62E
Molecular Weight: 53.6 kDa
Tag: N-terminal 6xHis-tagged
UniProt: P27113
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Yeast
Expression System: 24-495aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: WTYHFSAENMTYDEASAYCQQNYTHLVAIQNKEEIDYLNSILDYSPSYYWIGIRKVNNVWIWVGTHKPLTEGAKNWAPGEPNNKQNNEDCVEIYIKRPKDTGMWNDERCSKKKLALCYTAACTEASCSGHGECIETINNYSCKCYPGFSGLKCEQVVTCEAQVQPQHGSLNCTHPLGNFSYNSSCSVSCERGYLPSSTETTWCTSSGEWSAPPATCKVVECDTMGKPANGDVKCSPSQGSAPWNTTCTFDCEEG