Recombinant Human Selenoprotein P (SEPP1) (U59S,U300S,U318S,U330S,U345S,U352S,U367S,U369S,U376S,U378S)

Product Overview

• Article Name: Recombinant Human Selenoprotein P (SEPP1) (U59S,U300S,U318S,U330S,U345S,U352S,U367S,U369S,U376S,U378S)
• Biozol Catalog Number: CSB-YP021018HU
• Supplier Catalog Number: CSB-YP021018HU
• Alternative Catalog Number: CSB-YP021018HU-1, CSB-YP021018HU-100, CSB-YP021018HU-20
• Manufacturer: Cusabio
• Category: Proteine/Peptide
• Alternative Names: Selenoprotein P, Selenoprotein P plasma 1, Selp, SeP, Sepp1, SEPP1_HUMAN

Product Properties

• Molecular Weight: 42.6 kDa
• Tag: N-terminal 6xHis-tagged
• UniProt: P49908
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Yeast
• Expression System: 20-381aa(U59S,U300S,U318S,U330S,U345S,U352S,U367S,U369S,U376S,U378S)
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: ESQDQSSLCKQPPAWSIRDQDPMLNSNGSVTVVALLQASSYLCILQASKLEDLRVKLKKEGYSNISYIVVNHQGISSRLKYTHLKNKVSEHIPVYQQEENQTDVWTLLNGSKDDFLIYDRCGRLVYHLGLPFSFLTFPYVEEAIKIAYCEKKCGNCSLTTLKDEDFCKRVSLATVDKTVETPSPHYHHEHHHNHGHQHLGSSELSENQQPGAPNAPTHPAPPGLHHHHKHKGQHRQGHPENRDMPASEDLQDLQ