Recombinant Human Pulmonary surfactant-associated protein B (SFTPB)
Catalog Number:
CSB-YP021173HU
- Images (0)
| Article Name: | Recombinant Human Pulmonary surfactant-associated protein B (SFTPB) |
| Biozol Catalog Number: | CSB-YP021173HU |
| Supplier Catalog Number: | CSB-YP021173HU |
| Alternative Catalog Number: | CSB-YP021173HU-1, CSB-YP021173HU-100, CSB-YP021173HU-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | 18KDA pulmonary-surfactant protein 6KDA protein Pulmonary surfactant-associated proteolipid SPL(Phe) |
| Molecular Weight: | 8.7 kDa |
| Tag: | Tag-Free |
| UniProt: | P07988 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Yeast |
| Expression System: | 201-279aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | FPIPLPYCWLCRALIKRIQAMIPKGALAVAVAQVCRVVPLVAGGICQCLAERYSVILLDTLLGRMLPQLVCRLVLRCSM |
Product Guarantee and Expert Support
