Recombinant Pig Pulmonary surfactant-associated protein B (SFTPB)
Catalog Number:
CSB-YP021173PI
- Images (0)
| Article Name: | Recombinant Pig Pulmonary surfactant-associated protein B (SFTPB) |
| Biozol Catalog Number: | CSB-YP021173PI |
| Supplier Catalog Number: | CSB-YP021173PI |
| Alternative Catalog Number: | CSB-YP021173PI-1, CSB-YP021173PI-100, CSB-YP021173PI-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Pulmonary surfactant-associated protein B(SP-B)(8 kDa protein)(Pulmonary surfactant-associated proteolipid SPL(Phe)) |
| Molecular Weight: | 8.7 kDa |
| Tag: | Tag-Free |
| UniProt: | P15782 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Yeast |
| Expression System: | 1-79aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | FPIPLPFCWLCRTLIKRIQAVVPKGVLLKAVAQVCHVVPLPVGGICQCLAERYIVICLNMLLDRTLPQLVCGLVLRCSS |
Product Guarantee and Expert Support
