Recombinant Human Pulmonary surfactant-associated protein C (SFTPC)

Catalog Number: CSB-YP021174HU
Article Name: Recombinant Human Pulmonary surfactant-associated protein C (SFTPC)
Biozol Catalog Number: CSB-YP021174HU
Supplier Catalog Number: CSB-YP021174HU
Alternative Catalog Number: CSB-YP021174HU-1, CSB-YP021174HU-100, CSB-YP021174HU-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Pulmonary surfactant-associated proteolipid SPL(Val)SP5,CSB-PR2024
Molecular Weight: 5.7 kDa
Tag: N-terminal 6xHis-tagged
UniProt: P11686
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Yeast
Expression System: 24-58aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: FGIPCCPVHLKRLLIVVVVVVLIVVVIVGALLMGL