Recombinant Human Melanocyte protein PMEL (PMEL), partial
Catalog Number:
CSB-YP021324HU
- Images (0)
| Article Name: | Recombinant Human Melanocyte protein PMEL (PMEL), partial |
| Biozol Catalog Number: | CSB-YP021324HU |
| Supplier Catalog Number: | CSB-YP021324HU |
| Alternative Catalog Number: | CSB-YP021324HU-1, CSB-YP021324HU-100, CSB-YP021324HU-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | ME20-M ,ME20MMelanocyte protein Pmel 17Melanocytes lineage-specific antigen GP100Melanoma-associated ME20 antigen,P1,P100Premelanosome protein,Silver locus protein homolog |
| Molecular Weight: | 49 kDa |
| Tag: | N-terminal 6xHis-tagged |
| UniProt: | P40967 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Yeast |
| Expression System: | 25-467aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | KVPRNQDWLGVSRQLRTKAWNRQLYPEWTEAQRLDCWRGGQVSLKVSNDGPTLIGANASFSIALNFPGSQKVLPDGQVIWVNNTIINGSQVWGGQPVYPQETDDACIFPDGGPCPSGSWSQKRSFVYVWKTWGQYWQVLGGPVSGLSIGTGRAMLGTHTMEVTVYHRRGSRSYVPLAHSSSAFTITDQVPFSVSVSQLRALDGGNKHFLRNQPLTFALQLHDPSGYLAEADLSYTWDFGDSSGTLISRALVVTH |
Product Guarantee and Expert Support
