Recombinant Human Signal-regulatory protein beta-1 (SIRPB1), partial
Catalog Number:
CSB-YP021335HU
- Images (0)
| Article Name: | Recombinant Human Signal-regulatory protein beta-1 (SIRPB1), partial |
| Biozol Catalog Number: | CSB-YP021335HU |
| Supplier Catalog Number: | CSB-YP021335HU |
| Alternative Catalog Number: | CSB-YP021335HU-1, CSB-YP021335HU-100, CSB-YP021335HU-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | SIRP-beta-1 Alternative name(s): CD172 antigen-like family member B CD_antigen: CD172b |
| Molecular Weight: | 39.3 kDa |
| Tag: | N-terminal 6xHis-tagged |
| UniProt: | O00241 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Yeast |
| Expression System: | 30-371aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | EDELQVIQPEKSVSVAAGESATLRCAMTSLIPVGPIMWFRGAGAGRELIYNQKEGHFPRVTTVSELTKRNNLDFSISISNITPADAGTYYCVKFRKGSPDDVEFKSGAGTELSVRAKPSAPVVSGPAVRATPEHTVSFTCESHGFSPRDITLKWFKNGNELSDFQTNVDPAGDSVSYSIHSTARVVLTRGDVHSQVICEIAHITLQGDPLRGTANLSEAIRVPPTLEVTQQPMRAENQANVTCQVSNFYPRGLQ |
Product Guarantee and Expert Support
