Recombinant Mouse Excitatory amino acid transporter 2 (Slc1a2), partial
Catalog Number:
CSB-YP021433MO
- Images (0)
| Article Name: | Recombinant Mouse Excitatory amino acid transporter 2 (Slc1a2), partial |
| Biozol Catalog Number: | CSB-YP021433MO |
| Supplier Catalog Number: | CSB-YP021433MO |
| Alternative Catalog Number: | CSB-YP021433MO-1, CSB-YP021433MO-100, CSB-YP021433MO-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | GLT-1Sodium-dependent glutamate/aspartate transporter 2Solute carrier family 1 member 2 |
| Molecular Weight: | 37.6 kDa |
| Tag: | N-terminal GST-tagged |
| UniProt: | P43006 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Yeast |
| Expression System: | 143-238aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | HPGNPKLKKQLGPGKKNDEVSSLDAFLDLIRNLFPENLVQACFQQIQTVTKKVLVAPPSEEANTTKAVISMLNETMNEAPEETKIVIKKGLEFKDG |
Product Guarantee and Expert Support
