Recombinant Human Very long-chain acyl-CoA synthetase (SLC27A2), partial
Catalog Number:
CSB-YP021534HU
- Images (0)
| Article Name: | Recombinant Human Very long-chain acyl-CoA synthetase (SLC27A2), partial |
| Biozol Catalog Number: | CSB-YP021534HU |
| Supplier Catalog Number: | CSB-YP021534HU |
| Alternative Catalog Number: | CSB-YP021534HU-1, CSB-YP021534HU-100, CSB-YP021534HU-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Fatty acid transport protein 2 ,FATP-2Fatty-acid-coenzyme A ligase, very long-chain 1Long-chain-fatty-acid--CoA ligase (EC:6.2.1.3)Solute carrier family 27 member 2THCA-CoA ligaseVery long-chain-fatty-acid-CoA ligase |
| Molecular Weight: | 40.8 kDa |
| Tag: | N-terminal 6xHis-tagged |
| UniProt: | O14975 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Yeast |
| Expression System: | 283-620aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | GATLALRTKFSASQFWDDCRKYNVTVIQYIGELLRYLCNSPQKPNDRDHKVRLALGNGLRGDVWRQFVKRFGDICIYEFYAATEGNIGFMNYARKVGAVGRVNYLQKKIITYDLIKYDVEKDEPVRDENGYCVRVPKGEVGLLVCKITQLTPFNGYAGAKAQTEKKKLRDVFKKGDLYFNSGDLLMVDHENFIYFHDRVGDTFRWKGENVATTEVADTVGLVDFVQEVNVYGVHVPDHEGRIGMASIKMKENHE |
Product Guarantee and Expert Support
