Recombinant Human Sodium-dependent phosphate transport protein 2B (SLC34A2), partial
Catalog Number:
CSB-YP021581HU
- Images (0)
| Article Name: | Recombinant Human Sodium-dependent phosphate transport protein 2B (SLC34A2), partial |
| Biozol Catalog Number: | CSB-YP021581HU |
| Supplier Catalog Number: | CSB-YP021581HU |
| Alternative Catalog Number: | CSB-YP021581HU-1, CSB-YP021581HU-100, CSB-YP021581HU-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Na(+)-dependent phosphate cotransporter 2BNaPi3bSodium/phosphate cotransporter 2B ,Na(+)/Pi cotransporter 2B ,NaPi-2bSolute carrier family 34 member 2 |
| Molecular Weight: | 15.1 kDa |
| Tag: | N-terminal 6xHis-tagged |
| UniProt: | O95436 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Yeast |
| Expression System: | 574-689aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | LLQSRCPRVLPKKLQNWNFLPLWMRSLKPWDAVVSKFTGCFQMRCCCCCRVCCRACCLLCDCPKCCRCSKCCEDLEEAQEGQDVPVKAPETFDNITISREAQGEVPASDSKTECTA |
Product Guarantee and Expert Support
