Recombinant Mouse Asc-type amino acid transporter 1 (Slc7a10), partial
Catalog Number:
CSB-YP021710MO
- Images (0)
| Article Name: | Recombinant Mouse Asc-type amino acid transporter 1 (Slc7a10), partial |
| Biozol Catalog Number: | CSB-YP021710MO |
| Supplier Catalog Number: | CSB-YP021710MO |
| Alternative Catalog Number: | CSB-YP021710MO-1, CSB-YP021710MO-100, CSB-YP021710MO-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | D-serine transporter Solute carrier family 7 member 10,CSB-PR2024 |
| Molecular Weight: | 22.5 kDa |
| Tag: | N-terminal 6xHis-sumostar-tagged |
| UniProt: | P63115 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Yeast |
| Expression System: | 475-530aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | WRSKPKCVHRFTESMTRWGQELCFVVYPQGSLEEEENGPMGQPSPLPITDKPLKTQ |
Product Guarantee and Expert Support
