Recombinant Human Solute carrier organic anion transporter family member 2B1 (SLCO2B1), partial
Catalog Number:
CSB-YP021746HU
- Images (0)
| Article Name: | Recombinant Human Solute carrier organic anion transporter family member 2B1 (SLCO2B1), partial |
| Biozol Catalog Number: | CSB-YP021746HU |
| Supplier Catalog Number: | CSB-YP021746HU |
| Alternative Catalog Number: | CSB-YP021746HU-1, CSB-YP021746HU-100, CSB-YP021746HU-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Organic anion transporter B (OATP-B) (Organic anion transporter polypeptide-related protein 2) (OATP-RP2) (OATPRP2) (Solute carrier family 21 member 9) (KIAA0880) (OATP2B1) (OATPB) (SLC21A9) |
| Molecular Weight: | 13.0 kDa |
| Tag: | N-terminal 6xHis-tagged |
| UniProt: | O94956 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Yeast |
| Expression System: | 461-564aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | FFIGCSSHQIAGITHQTSAHPGLELSPSCMEACSCPLDGFNPVCDPSTRVEYITPCHAGCSSWVVQDALDNSQVFYTNCSCVVEGNPVLAGSCDSTCSHLVVPF |
Product Guarantee and Expert Support
