Recombinant Human Secreted Ly-6/uPAR-related protein 1 (SLURP1)
Catalog Number:
CSB-YP021784HU
- Images (0)
| Article Name: | Recombinant Human Secreted Ly-6/uPAR-related protein 1 (SLURP1) |
| Biozol Catalog Number: | CSB-YP021784HU |
| Supplier Catalog Number: | CSB-YP021784HU |
| Alternative Catalog Number: | CSB-YP021784HU-1, CSB-YP021784HU-100, CSB-YP021784HU-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | ARS component B ARS(component B)-81/S Anti-neoplastic urinary protein Short name: ANUP |
| Molecular Weight: | 10.9 kDa |
| Tag: | N-terminal 6xHis-tagged |
| UniProt: | P55000 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Yeast |
| Expression System: | 23-103aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | LKCYTCKEPMTSASCRTITRCKPEDTACMTTLVTVEAEYPFNQSPVVTRSCSSSCVATDPDSIGAAHLIFCCFRDLCNSEL |
Product Guarantee and Expert Support
