Recombinant Rat Superoxide dismutase [Cu-Zn] (Sod1)

Catalog Number: CSB-YP022397RA
Article Name: Recombinant Rat Superoxide dismutase [Cu-Zn] (Sod1)
Biozol Catalog Number: CSB-YP022397RA
Supplier Catalog Number: CSB-YP022397RA
Alternative Catalog Number: CSB-YP022397RA-1, CSB-YP022397RA-100, CSB-YP022397RA-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: ,CSB-PR2024
Molecular Weight: 17.3 kDa
Tag: N-terminal 6xHis-tagged
UniProt: P07632
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Yeast
Expression System: 2-154aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: AMKAVCVLKGDGPVQGVIHFEQKASGEPVVVSGQITGLTEGEHGFHVHQYGDNTQGCTTAGPHFNPHSKKHGGPADEERHVGDLGNVAAGKDGVANVSIEDRVISLSGEHSIIGRTMVVHEKQDDLGKGGNEESTKTGNAGSRLACGVIGIAQ