Recombinant Human Small proline-rich protein 2B (SPRR2B)
Catalog Number:
CSB-YP022613HUB1
- Images (0)
| Article Name: | Recombinant Human Small proline-rich protein 2B (SPRR2B) |
| Biozol Catalog Number: | CSB-YP022613HUB1 |
| Supplier Catalog Number: | CSB-YP022613HUb1 |
| Alternative Catalog Number: | CSB-YP022613HUB1-1, CSB-YP022613HUB1-100, CSB-YP022613HUB1-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | SPRR2B, Small proline-rich protein 2B, SPR-2B |
| Molecular Weight: | 12 kDa |
| Tag: | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| UniProt: | P35325 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Yeast |
| Expression System: | 1-72aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPPPKCPQPCPPQQCQQKYPPVTPSPPCQPKYPPKSK |
Product Guarantee and Expert Support
