Recombinant Human Serum response factor (SRF)
Catalog Number:
CSB-YP022659HU
- Images (0)
| Article Name: | Recombinant Human Serum response factor (SRF) |
| Biozol Catalog Number: | CSB-YP022659HU |
| Supplier Catalog Number: | CSB-YP022659HU |
| Alternative Catalog Number: | CSB-YP022659HU-1, CSB-YP022659HU-100, CSB-YP022659HU-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | c fos serum response element binding factor, c fos serum response element binding transcription factor, ELK3, ERP, MCM 1, MCM1, OTTHUMP00000039820, SAP2, Serum response factor, SRF, SRF serum response factor c fos serum response element binding transcrip |
| Molecular Weight: | 53.6 kDa |
| Tag: | N-terminal 6xHis-tagged |
| UniProt: | P11831 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Yeast |
| Expression System: | 1-508aa |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | MLPTQAGAAAALGRGSALGGSLNRTPTGRPGGGGGTRGANGGRVPGNGAGLGPGRLEREAAAAAATTPAPTAGALYSGSEGDSESGEEEELGAERRGLKRSLSEMEIGMVVGGPEASAAATGGYGPVSGAVSGAKPGKKTRGRVKIKMEFIDNKLRRYTTFSKRKTGIMKKAYELSTLTGTQVLLLVASETGHVYTFATRKLQPMITSETGKALIQTCLNSPDSPPRSDPTTDQRMSATGFEETDLTYQVSESD |
Product Guarantee and Expert Support
