Recombinant Enterobacteria phage T4 Single-stranded DNA-binding protein (32)
Catalog Number:
CSB-YP022706EDZ
- Images (0)
| Article Name: | Recombinant Enterobacteria phage T4 Single-stranded DNA-binding protein (32) |
| Biozol Catalog Number: | CSB-YP022706EDZ |
| Supplier Catalog Number: | CSB-YP022706EDZ |
| Alternative Catalog Number: | CSB-YP022706EDZ-1, CSB-YP022706EDZ-100, CSB-YP022706EDZ-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | (SSB protein)(Gp32)(Helix-destabilizing protein) |
| Molecular Weight: | 35.0 kDa |
| Tag: | C-terminal 6xHis-tagged |
| UniProt: | P03695 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Yeast |
| Expression System: | 1-301aa |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | MFKRKSTAELAAQMAKLNGNKGFSSEDKGEWKLKLDNAGNGQAVIRFLPSKNDEQAPFAILVNHGFKKNGKWYIETCSSTHGDYDSCPVCQYISKNDLYNTDNKEYSLVKRKTSYWANILVVKDPAAPENEGKVFKYRFGKKIWDKINAMIAVDVEMGETPVDVTCPWEGANFVLKVKQVSGFSNYDESKFLNQSAIPNIDDESFQKELFEQMVDLSEMTSKDKFKSFEELNTKFGQVMGTAVMGGAAATAAKK |
Product Guarantee and Expert Support
