Recombinant Rat Synapsin-1 (Syn1), partial

Catalog Number: CSB-YP023002RA
Article Name: Recombinant Rat Synapsin-1 (Syn1), partial
Biozol Catalog Number: CSB-YP023002RA
Supplier Catalog Number: CSB-YP023002RA
Alternative Catalog Number: CSB-YP023002RA-1, CSB-YP023002RA-100, CSB-YP023002RA-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: (Synapsin I)
Molecular Weight: 35.6 kDa
Tag: C-terminal 6xHis-tagged
UniProt: P09951
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Yeast
Expression System: 113-420aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: ARVLLVIDEPHTDWAKYFKGKKIHGEIDIKVEQAEFSDLNLVAHANGGFSVDMEVLRNGVKVVRSLKPDFVLIRQHAFSMARNGDYRSLVIGLQYAGIPSVNSLHSVYNFCDKPWVFAQMVRLHKKLGTEEFPLIDQTFYPNHKEMLSSTTYPVVVKMGHAHSGMGKVKVDNQHDFQDIASVVALTKTYATAEPFIDAKYDVRVQKIGQNYKAYMRTSVSGNWKTNTGSAMLEQIAMSDRYKLWVDTCSEIFGG