Recombinant Pig Transcobalamin-1 (TCN1)
Catalog Number:
CSB-YP023317PI
- Images (0)
| Article Name: | Recombinant Pig Transcobalamin-1 (TCN1) |
| Biozol Catalog Number: | CSB-YP023317PI |
| Supplier Catalog Number: | CSB-YP023317PI |
| Alternative Catalog Number: | CSB-YP023317PI-1, CSB-YP023317PI-100, CSB-YP023317PI-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | CobalophilinHaptocorrin,Protein RTranscobalamin I ,TC I ,TCI |
| Molecular Weight: | 46.3 kDa |
| Tag: | N-terminal 6xHis-tagged |
| UniProt: | P17630 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Yeast |
| Expression System: | 25-416aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | CVVSEKDYSHLRLLISAMDNLEQIRGIYGASILLSQRLAGIQNPSLEEELSQRIQDDMNRRDMSNLTSGQLALIILAFGACKTPDVRFIHDHHLVEKLGEKFKEEIKNMEIHNSNPLTNYYQLSFDVLTLCLFRGNYSISNVTHYFNPENKNFNLSGHFSVDTGAVAVLALTCVKRSISNGKIKAAIKDSDTIQKYIESLVHKIQSEKMVVSLETRIAQEKLCRLSLSHQTITKMNQIAKKLWTRCLTHSQGVF |
Product Guarantee and Expert Support
