Recombinant Human Trefoil factor 1 (TFF1)
Catalog Number:
CSB-YP023431HU
- Images (0)
| Article Name: | Recombinant Human Trefoil factor 1 (TFF1) |
| Biozol Catalog Number: | CSB-YP023431HU |
| Supplier Catalog Number: | CSB-YP023431HU |
| Alternative Catalog Number: | CSB-YP023431HU-1, CSB-YP023431HU-100, CSB-YP023431HU-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Breast cancer estrogen-inducible protein,PNR-2,Polypeptide P1.A ,hP1.AProtein pS2 |
| Molecular Weight: | 8.7 kDa |
| Tag: | N-terminal 6xHis-tagged |
| UniProt: | P04155 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Yeast |
| Expression System: | 25-84aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | EAQTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFYPNTIDVPPEEECEF |
Product Guarantee and Expert Support
