Recombinant Sheep Protransforming growth factor alpha (TGFA), partial
Catalog Number:
CSB-YP023445SH
- Images (0)
| Article Name: | Recombinant Sheep Protransforming growth factor alpha (TGFA), partial |
| Biozol Catalog Number: | CSB-YP023445SH |
| Supplier Catalog Number: | CSB-YP023445SH |
| Alternative Catalog Number: | CSB-YP023445SH-1, CSB-YP023445SH-100, CSB-YP023445SH-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | EGF-like TGF Short name: ETGF TGF type 1 |
| Molecular Weight: | 34.9 kDa |
| Tag: | N-terminal GST-tagged |
| UniProt: | P98135 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Yeast |
| Expression System: | 24-97aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | ENSTSALSDPPVAAAVVSHFNDCPDSHTQFCFHGTCRFLLQEEKPACVCHSGYVGARCEHADLLAVVAASQKKQ |
Product Guarantee and Expert Support
