Recombinant Xenopus laevis Transforming growth factor beta-1 (TGFB1)
Catalog Number:
CSB-YP023446XBE
- Images (0)
| Article Name: | Recombinant Xenopus laevis Transforming growth factor beta-1 (TGFB1) |
| Biozol Catalog Number: | CSB-YP023446XBE |
| Supplier Catalog Number: | CSB-YP023446XBE |
| Alternative Catalog Number: | CSB-YP023446XBE-1, CSB-YP023446XBE-100, CSB-YP023446XBE-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | TGF-beta-5 |
| Molecular Weight: | 14.6 kDa |
| Tag: | N-terminal 6xHis-tagged |
| UniProt: | P16176 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Yeast |
| Expression System: | 271-382aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | GVGQEYCFGNNGPNCCVKPLYINFRKDLGWKWIHEPKGYEANYCLGNCPYIWSMDTQYSKVLSLYNQNNPGASISPCCVPDVLEPLPIIYYVGRTAKVEQLSNMVVRSCNCS |
Product Guarantee and Expert Support
