Recombinant Mouse Toll-like receptor 4 (Tlr4), partial
Catalog Number:
CSB-YP023603MO
- Images (0)
| Article Name: | Recombinant Mouse Toll-like receptor 4 (Tlr4), partial |
| Biozol Catalog Number: | CSB-YP023603MO |
| Supplier Catalog Number: | CSB-YP023603MO |
| Alternative Catalog Number: | CSB-YP023603MO-1, CSB-YP023603MO-100, CSB-YP023603MO-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | CD_antigen: CD284 |
| Molecular Weight: | 71.5 kDa |
| Tag: | N-terminal 6xHis-tagged |
| UniProt: | Q9QUK6 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Yeast |
| Expression System: | 26-638aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | NPCIEVVPNITYQCMDQKLSKVPDDIPSSTKNIDLSFNPLKILKSYSFSNFSELQWLDLSRCEIETIEDKAWHGLHHLSNLILTGNPIQSFSPGSFSGLTSLENLVAVETKLASLESFPIGQLITLKKLNVAHNFIHSCKLPAYFSNLTNLVHVDLSYNYIQTITVNDLQFLRENPQVNLSLDMSLNPIDFIQDQAFQGIKLHELTLRGNFNSSNIMKTCLQNLAGLHVHRLILGEFKDERNLEIFEPSIMEGL |
Product Guarantee and Expert Support
