Recombinant Human Toll-like receptor 8 (TLR8), partial

Catalog Number: CSB-YP023607HU
Article Name: Recombinant Human Toll-like receptor 8 (TLR8), partial
Biozol Catalog Number: CSB-YP023607HU
Supplier Catalog Number: CSB-YP023607HU
Alternative Catalog Number: CSB-YP023607HU-1, CSB-YP023607HU-100, CSB-YP023607HU-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: CD288
Molecular Weight: 93.5 kDa
Tag: N-terminal 6xHis-tagged
UniProt: Q9NR97
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Yeast
Expression System: 27-827aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: EENFSRSYPCDEKKQNDSVIAECSNRRLQEVPQTVGKYVTELDLSDNFITHITNESFQGLQNLTKINLNHNPNVQHQNGNPGIQSNGLNITDGAFLNLKNLRELLLEDNQLPQIPSGLPESLTELSLIQNNIYNITKEGISRLINLKNLYLAWNCYFNKVCEKTNIEDGVFETLTNLELLSLSFNSLSHVPPKLPSSLRKLFLSNTQIKYISEEDFKGLINLTLLDLSGNCPRCFNAPFPCVPCDGGASINIDR