Recombinant Human Transmembrane 4 L6 family member 1 (TM4SF1), partial

Catalog Number: CSB-YP023615HU1
Article Name: Recombinant Human Transmembrane 4 L6 family member 1 (TM4SF1), partial
Biozol Catalog Number: CSB-YP023615HU1
Supplier Catalog Number: CSB-YP023615HU1
Alternative Catalog Number: CSB-YP023615HU1-1, CSB-YP023615HU1-100, CSB-YP023615HU1-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Membrane component chromosome 3 surface marker 1 Tumor-associated antigen L6
Molecular Weight: 7.3 kDa
Tag: N-terminal 6xHis-tagged
UniProt: P30408
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Yeast
Expression System: 115-161aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: LAEGPLCLDSLGQWNYTFASTEGQYLLDTSTWSECTEPKHIVEWNVS