Recombinant Human Tumor necrosis factor receptor superfamily member 1A (TNFRSF1A), partial
Catalog Number:
CSB-YP023977HU1
- Images (0)
| Article Name: | Recombinant Human Tumor necrosis factor receptor superfamily member 1A (TNFRSF1A), partial |
| Biozol Catalog Number: | CSB-YP023977HU1 |
| Supplier Catalog Number: | CSB-YP023977HU1 |
| Alternative Catalog Number: | CSB-YP023977HU1-1, CSB-YP023977HU1-100, CSB-YP023977HU1-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Tumor necrosis factor receptor 1 (TNF-R1) (Tumor necrosis factor receptor type I) (TNF-RI) (TNFR-I) (p55) (p60) (CD_antigen: CD120a) (TNFAR) (TNFR1) |
| Molecular Weight: | 22.7 kDa |
| Tag: | C-terminal 6xHis-tagged |
| UniProt: | P19438 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Yeast |
| Expression System: | 22-211aa |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | IYPSGVIGLVPHLGDREKRDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIENVKGTEDSGTT |
Product Guarantee and Expert Support
