Recombinant Human Tumor necrosis factor receptor superfamily member 1B (TNFRSF1B), partial
Catalog Number:
CSB-YP023978HU2
- Images (0)
| Article Name: | Recombinant Human Tumor necrosis factor receptor superfamily member 1B (TNFRSF1B), partial |
| Biozol Catalog Number: | CSB-YP023978HU2 |
| Supplier Catalog Number: | CSB-YP023978HU2 |
| Alternative Catalog Number: | CSB-YP023978HU2-1, CSB-YP023978HU2-100, CSB-YP023978HU2-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Tumor necrosis factor receptor 2 ,TNF-R2Tumor necrosis factor receptor type II ,TNF-RII ,TNFR-IIp75p80 TNF-alpha receptor, CD120bINN: Etanercept |
| Molecular Weight: | 25.9 kDa |
| Tag: | C-terminal 6xHis-tagged |
| UniProt: | P20333 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Yeast |
| Expression System: | 23-257aa |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | LPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVVAIPGNASMDAVCTSTSPTRSMAPGAVHLPQPVSTRSQHTQPTPEPSTAPSTSFLLPMGPSPPAEGSTGD |
Product Guarantee and Expert Support
