Recombinant Rabbit Tumor necrosis factor ligand superfamily member 4 (TNFSF4), partial
Catalog Number:
CSB-YP023994RB1
- Images (0)
| Article Name: | Recombinant Rabbit Tumor necrosis factor ligand superfamily member 4 (TNFSF4), partial |
| Biozol Catalog Number: | CSB-YP023994RB1 |
| Supplier Catalog Number: | CSB-YP023994RB1 |
| Alternative Catalog Number: | CSB-YP023994RB1-1, CSB-YP023994RB1-100, CSB-YP023994RB1-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Tumor necrosis factor ligand superfamily member 4(OX40 ligand)(OX40L)(CD antigen CD252),CSB-PR2024 |
| Molecular Weight: | 19.8 kDa |
| Tag: | C-terminal 6xHis-tagged and Myc-tagged |
| UniProt: | O02765 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Yeast |
| Expression System: | 45-187aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | QHSHAPEVSLQYPPIENIMTQLQILTSHECEEDSFILPLQKRDGTMEVQNNSVVIQCDGFYLLSLKGYFSQEVSISLHYRKGEEPFPILKKTKFANSNVVLKLGYKDKVYLNVTTDSASCKQLSVNAGELIVILQNPGGYCAP |
Product Guarantee and Expert Support
