Recombinant Mouse Tenomodulin (Tnmd), partial

Catalog Number: CSB-YP024007MO
Article Name: Recombinant Mouse Tenomodulin (Tnmd), partial
Biozol Catalog Number: CSB-YP024007MO
Supplier Catalog Number: CSB-YP024007MO
Alternative Catalog Number: CSB-YP024007MO-1, CSB-YP024007MO-100, CSB-YP024007MO-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Chondromodulin-1-like protein (ChM1L) (mChM1L) (Chondromodulin-I-like protein) (Myodulin) (Tendin) (TeM) (mTeM) (Chm1l)
Molecular Weight: 34.1 kDa
Tag: N-terminal 10xHis-tagged
UniProt: Q9EP64
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Yeast
Expression System: 51-317aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: KHFWPEVSKKTYDMEHTFYSNGEKKKIYMEIDPITRTEIFRSGNGTDETLEVHDFKNGYTGIYFVGLQKCFIKTQIKVIPEFSEPEEEIDENEEITTTFFEQSVIWVPAEKPIENRDFLKNSKILEICDNVTMYWINPTLIAVSELQDFEEDGEDLHFPTSEKKGIDQNEQWVVPQVKVEKTRHTRQASEEDLPINDYTENGIEFDPMLDERGYCCIYCRRGNRYCRRVCEPLLGYYPYPYCYQGGRVICRVIM