Recombinant Human Tetraspanin-2 (TSPAN2), partial
Catalog Number:
CSB-YP025157HU1
- Images (0)
| Article Name: | Recombinant Human Tetraspanin-2 (TSPAN2), partial |
| Biozol Catalog Number: | CSB-YP025157HU1 |
| Supplier Catalog Number: | CSB-YP025157HU1 |
| Alternative Catalog Number: | CSB-YP025157HU1-1, CSB-YP025157HU1-100, CSB-YP025157HU1-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | TSPAN2Tetraspanin-2, Tspan-2, Tetraspan NET-3 |
| Molecular Weight: | 9.5 kDa |
| Tag: | C-terminal 6xHis-tagged |
| UniProt: | O60636 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Yeast |
| Expression System: | 112-188aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | GKGVAIRHVQTMYEEAYNDYLKDRGKGNGTLITFHSTFQCCGKESSEQVQPTCPKELLGHKNCIDEIETIISVKLQL |
Product Guarantee and Expert Support
